Lineage for d1irl__ (1irl -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2696Family a.26.1.2: Short-chain cytokines [47286] (9 proteins)
  6. 2714Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 2715Species Human (Homo sapiens) [TaxId:9606] [47302] (2 PDB entries)
  8. 2718Domain d1irl__: 1irl - [16883]

Details for d1irl__

PDB Entry: 1irl (more details)

PDB Description: the solution structure of the f42a mutant of human interleukin 2

SCOP Domain Sequences for d1irl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irl__ a.26.1.2 (-) Interleukin-2 (IL-2) {Human (Homo sapiens)}
aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt

SCOP Domain Coordinates for d1irl__:

Click to download the PDB-style file with coordinates for d1irl__.
(The format of our PDB-style files is described here.)

Timeline for d1irl__: