SCOPe 2.02: Domain d2vrfa_: 2vrf A:

Lineage for d2vrfa_ (2vrf A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (15 PDB entries)

8. Domain d2vrfa_: 2vrf A: [168768]
   automated match to d1qava_
   complexed with edo

Details for d2vrfa_

PDB Entry: 2vrf, 2 Å

PDB Description: crystal structure of the human beta-2-syntrophin pdz domain

PDB Compounds: (A:) beta-2-syntrophin

SCOPe Domain Sequences for d2vrfa_:

Sequence; same for both SEQRES and ATOM records:

>d2vrfa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smpvrrvrvvkqeagglgisikggrenrmpiliskifpglaadqsralrlgdailsvngt
dlrqathdqavqalkragkevllevkfirevntvv

Timeline for d2vrfa_:

• d2vrfa_ first appeared in SCOPe 2.01
  
• d2vrfa_ appears in SCOPe 2.03
  
• d2vrfa_ appears in the current release, SCOPe 2.08, called d2vrfa1