SCOPe 2.08: Domain d2vlvb_: 2vlv B:

Lineage for d2vlvb_ (2vlv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Hordeum vulgare [TaxId:112509] [188423] (3 PDB entries)

8. Domain d2vlvb_: 2vlv B: [168692]
   automated match to d1xfla_

Details for d2vlvb_

PDB Entry: 2vlv, 1.7 Å

PDB Description: crystal structure of barley thioredoxin h isoform 2 in partially radiation-reduced state

PDB Compounds: (B:) thioredoxin h isoform 2.

SCOPe Domain Sequences for d2vlvb_:

Sequence; same for both SEQRES and ATOM records:

>d2vlvb_ c.47.1.0 (B:) automated matches {Hordeum vulgare [TaxId: 112509]}
avaaevisvhsleqwtmqieeantakklvvidftaswcgpcrimapvfadlakkfpnavf
lkvdvdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaaq

Timeline for d2vlvb_:

• d2vlvb_ first appeared in SCOPe 2.01
  
• d2vlvb_ appears in SCOPe 2.07