Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily) core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213 |
Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) N- and C-termini undergo large conformational rearrangement upon ligand binding automatically mapped to Pfam PF02301 |
Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins) |
Protein automated matches [190416] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187293] (2 PDB entries) |
Domain d2vfxg_: 2vfx G: [168530] automated match to d1s2ha_ complexed with cl, mg, pe3, pe4, peg |
PDB Entry: 2vfx (more details), 1.95 Å
SCOPe Domain Sequences for d2vfxg_:
Sequence, based on SEQRES records: (download)
>d2vfxg_ d.135.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmalqlsreqgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdl elikylnnvveqlkdwlykssvqklvvvisniesgevlerwqfdiesdktakddsaprek sqkaiqdeirsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnse evrlrsftttihkvnsmvaykipvnd
>d2vfxg_ d.135.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmalqlsreqgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdl elikylnnvveqlkdwlykssvqklvvvisniesgevlerwqfdiesdktakapreksqk aiqdeirsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevr lrsftttihkvnsmvaykipvnd
Timeline for d2vfxg_: