Lineage for d2vfxe_ (2vfx E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977796Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 2977797Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
    automatically mapped to Pfam PF02301
  5. 2977798Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)
  6. 2977810Protein automated matches [190416] (1 species)
    not a true protein
  7. 2977811Species Human (Homo sapiens) [TaxId:9606] [187293] (2 PDB entries)
  8. 2977816Domain d2vfxe_: 2vfx E: [168528]
    automated match to d1s2ha_
    complexed with cl, mg, pe3, pe4, peg

Details for d2vfxe_

PDB Entry: 2vfx (more details), 1.95 Å

PDB Description: structure of the symmetric mad2 dimer
PDB Compounds: (E:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d2vfxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfxe_ d.135.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmalqlsreqgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdl
elikylnnvveqlkdwlykssvqklvvvisniesgevlerwqfdiesdktakddsaprek
sqkaiqdeirsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnse
evrlrsftttihkvnsmvaykipvnd

SCOPe Domain Coordinates for d2vfxe_:

Click to download the PDB-style file with coordinates for d2vfxe_.
(The format of our PDB-style files is described here.)

Timeline for d2vfxe_: