Lineage for d2v8ub_ (2v8u B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085512Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
  6. 1085535Protein automated matches [190575] (2 species)
    not a true protein
  7. 1085536Species Thermus thermophilus [TaxId:262724] [188041] (2 PDB entries)
  8. 1085540Domain d2v8ub_: 2v8u B: [168380]
    automated match to d2cwla1
    complexed with li, mn, o, so4

Details for d2v8ub_

PDB Entry: 2v8u (more details), 1.05 Å

PDB Description: atomic resolution structure of mn catalase from thermus thermophilus
PDB Compounds: (B:) manganese-containing pseudocatalase

SCOPe Domain Sequences for d2v8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v8ub_ a.25.1.3 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpastplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklyek
ak

SCOPe Domain Coordinates for d2v8ub_:

Click to download the PDB-style file with coordinates for d2v8ub_.
(The format of our PDB-style files is described here.)

Timeline for d2v8ub_: