SCOPe 2.08: Domain d2v8ub_: 2v8u B:

Lineage for d2v8ub_ (2v8u B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
   automatically mapped to Pfam PF05067

6. Protein automated matches [190575] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [188041] (3 PDB entries)

8. Domain d2v8ub_: 2v8u B: [168380]
   automated match to d2cwla1
   complexed with li, mn, o, so4

Details for d2v8ub_

PDB Entry: 2v8u, 1.05 Å

PDB Description: atomic resolution structure of mn catalase from thermus thermophilus

PDB Compounds: (B:) manganese-containing pseudocatalase

SCOPe Domain Sequences for d2v8ub_:

Sequence; same for both SEQRES and ATOM records:

>d2v8ub_ a.25.1.3 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpastplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklyek
ak

Timeline for d2v8ub_:

• d2v8ub_ first appeared in SCOPe 2.01
  
• d2v8ub_ appears in SCOPe 2.07