Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins) automatically mapped to Pfam PF00850 |
Protein automated matches [190786] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries) |
Domain d2v5wb_: 2v5w B: [168358] automated match to d1t64a_ complexed with k, zn |
PDB Entry: 2v5w (more details), 2 Å
SCOPe Domain Sequences for d2v5wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5wb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeemat fhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidg mckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedaf sftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlk evyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggfnla ntarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyi kgnlkhv
Timeline for d2v5wb_: