Lineage for d2v5ub_ (2v5u B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158545Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1158546Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1158656Protein automated matches [190443] (4 species)
    not a true protein
  7. 1158657Species Anabaena sp. [TaxId:1168] [188238] (4 PDB entries)
  8. 1158661Domain d2v5ub_: 2v5u B: [168354]
    automated match to d1obva_
    complexed with fmn

Details for d2v5ub_

PDB Entry: 2v5u (more details), 1.99 Å

PDB Description: i92a flavodoxin from anabaena
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d2v5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5ub_ c.23.5.1 (B:) automated matches {Anabaena sp. [TaxId: 1168]}
akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqagyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d2v5ub_:

Click to download the PDB-style file with coordinates for d2v5ub_.
(The format of our PDB-style files is described here.)

Timeline for d2v5ub_: