SCOPe 2.01: Domain d2v5ub_: 2v5u B:

Lineage for d2v5ub_ (2v5u B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein automated matches [190443] (3 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1168] [188238] (4 PDB entries)

8. Domain d2v5ub_: 2v5u B: [168354]
   automated match to d1obva_
   complexed with fmn

Details for d2v5ub_

PDB Entry: 2v5u, 1.99 Å

PDB Description: i92a flavodoxin from anabaena

PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d2v5ub_:

Sequence; same for both SEQRES and ATOM records:

>d2v5ub_ c.23.5.1 (B:) automated matches {Anabaena sp. [TaxId: 1168]}
akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqagyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

Timeline for d2v5ub_:

• d2v5ub_ is new in SCOPe 2.01-stable
  
• d2v5ub_ appears in SCOPe 2.02
  
• d2v5ub_ appears in the current release, SCOPe 2.08