SCOP 1.69: Domain d1huw__: 1huw -

Lineage for d1huw__ (1huw -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Growth hormone, somatotropin [47276] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries)

8. Domain d1huw__: 1huw - [16831]

Details for d1huw__

PDB Entry: 1huw, 2 Å

PDB Description: the crystal structure of affinity-matured human growth hormone at 2 angstroms resolution

SCOP Domain Sequences for d1huw__:

Sequence; same for both SEQRES and ATOM records:

>d1huw__ a.26.1.1 (-) Growth hormone, somatotropin {Human (Homo sapiens)}
fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
iqtlmgrleallknygllycfnkdmskvstylrtvqcrsvegscgf

Timeline for d1huw__:

• d1huw__ first appeared (with stable ids) in SCOP 1.55
  
• d1huw__ appears in SCOP 1.67
  
• d1huw__ appears in SCOP 1.71
  
• d1huw__ appears in the current release, SCOPe 2.08, called d1huwa_