SCOPe 2.02: Domain d2v2gb_: 2v2g B:

Lineage for d2v2gb_ (2v2g B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (10 species)
   not a true protein

7. Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)

8. Domain d2v2gb_: 2v2g B: [168306]
   automated match to d1prxb_
   complexed with bez, gol; mutant

Details for d2v2gb_

PDB Entry: 2v2g, 1.6 Å

PDB Description: crystal structure of the c45s mutant of the peroxiredoxin 6 of arenicola marina. monoclinic form

PDB Compounds: (B:) peroxiredoxin 6

SCOPe Domain Sequences for d2v2gb_:

Sequence; same for both SEQRES and ATOM records:

>d2v2gb_ c.47.1.10 (B:) automated matches {Arenicola marina [TaxId: 6344]}
gitlgevfpnfeadstigklkfhdwlgnswgvlfshprdftpvsttelgrviqlegdfkk
rgvklialscdnvadhkewsedvkclsgvkgdmpypiiadetrelavklgmvdpdertst
gmpltcravfiigpdkklklsilypattgrnfseilrvidslqltaqkkvatpadwqpgd
rcmvvpgvsaeeaktlfpnmevkavpsgkgylrytpqp

Timeline for d2v2gb_:

• d2v2gb_ first appeared in SCOPe 2.01
  
• d2v2gb_ appears in SCOPe 2.03
  
• d2v2gb_ appears in the current release, SCOPe 2.08