| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
| Family d.151.1.1: DNase I-like [56220] (7 proteins) |
| Protein automated matches [190454] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187368] (3 PDB entries) |
| Domain d2v0sa_: 2v0s A: [168277] automated match to d1vyba_ complexed with gol, mn, so4 |
PDB Entry: 2v0s (more details), 1.8 Å
SCOPe Domain Sequences for d2v0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v0sa_ d.151.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqang
kqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfikq
vlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlhpk
steytfstangeskidhivgskallskckrteiitnylsdhsaiklelr
Timeline for d2v0sa_: