Lineage for d2v0sa_ (2v0s A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044453Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1044454Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1044455Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1044503Protein automated matches [190454] (2 species)
    not a true protein
  7. 1044504Species Human (Homo sapiens) [TaxId:9606] [187368] (3 PDB entries)
  8. 1044505Domain d2v0sa_: 2v0s A: [168277]
    automated match to d1vyba_
    complexed with gol, mn, so4

Details for d2v0sa_

PDB Entry: 2v0s (more details), 1.8 Å

PDB Description: crystal structure of a hairpin exchange variant (lr1) of the targeting line-1 retrotransposon endonuclease
PDB Compounds: (A:) lr1

SCOPe Domain Sequences for d2v0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v0sa_ d.151.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqang
kqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfikq
vlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlhpk
steytfstangeskidhivgskallskckrteiitnylsdhsaiklelr

SCOPe Domain Coordinates for d2v0sa_:

Click to download the PDB-style file with coordinates for d2v0sa_.
(The format of our PDB-style files is described here.)

Timeline for d2v0sa_: