Lineage for d1vyba_ (1vyb A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.151: DNase I-like [56218] (1 superfamily)
contains beta-sandwich; duplication of alpha+beta motifSuperfamily d.151.1: DNase I-like [56219] (4 families) 
Family d.151.1.1: DNase I-like [56220] (7 proteins) 
Protein Endonuclease domain of LINE-1 reverse transcriptase homolog [111211] (1 species) Species Human (Homo sapiens) [TaxId:9606] [111212] (1 PDB entry)
Uniprot P08547 2-237
Domain d1vyba_: 1vyb A: [108897]
complexed with gol, so3, so4
Details for d1vyba_
PDB Entry: 1vyb (more details), 1.8 Å
PDB Description: endonuclease domain of human line1 orf2p
PDB Compounds: (A:) orf2 contains a reverse transcriptase domainSCOPe Domain Sequences for d1vyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]}
gsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrki
yqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgap
rfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyr
tlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
SCOPe Domain Coordinates for d1vyba_:
Click to download the PDB-style file with coordinates for d1vyba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vyba_:
- d1vyba_ first appeared in SCOP 1.69
- d1vyba_ appears in SCOP 1.75
- d1vyba_ appears in SCOPe 2.02
- d1vyba_ appears in the current release, SCOPe 2.08
View in 3D
