Lineage for d2uzue_ (2uzu E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043604Protein automated matches [190091] (8 species)
    not a true protein
  7. 1043626Species Cow (Bos taurus) [TaxId:9913] [187007] (27 PDB entries)
  8. 1043663Domain d2uzue_: 2uzu E: [168265]
    automated match to d1apme_
    complexed with l20

Details for d2uzue_

PDB Entry: 2uzu (more details), 2.4 Å

PDB Description: pka structures of indazole-pyridine series of akt inhibitors
PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d2uzue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzue_ d.144.1.7 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d2uzue_:

Click to download the PDB-style file with coordinates for d2uzue_.
(The format of our PDB-style files is described here.)

Timeline for d2uzue_: