Lineage for d2uyha_ (2uyh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129999Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 protein domains)
    automatically mapped to Pfam PF00145
  6. 2130040Protein automated matches [190244] (3 species)
    not a true protein
  7. 2130045Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries)
  8. 2130051Domain d2uyha_: 2uyh A: [168229]
    automated match to d10mha_
    protein/DNA complex; complexed with sah, so4; mutant

Details for d2uyha_

PDB Entry: 2uyh (more details), 2.63 Å

PDB Description: hhai dna methyltransferase s87q-q237s mutant complex with 13mer gcgc-gmgc oligonucleotide and sah
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2uyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyha_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsiqgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggsger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2uyha_:

Click to download the PDB-style file with coordinates for d2uyha_.
(The format of our PDB-style files is described here.)

Timeline for d2uyha_: