SCOPe 2.08: Domain d2uxra_: 2uxr A:

Lineage for d2uxra_ (2uxr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (25 species)
   not a true protein

7. Species Desulfotalea psychrophila [TaxId:84980] [188344] (3 PDB entries)

8. Domain d2uxra_: 2uxr A: [168218]
   automated match to d1lwda_
   complexed with gol, ict, mg

Details for d2uxra_

PDB Entry: 2uxr, 2.3 Å

PDB Description: complex with isocitrate and the protein isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila

PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d2uxra_:

Sequence; same for both SEQRES and ATOM records:

>d2uxra_ c.77.1.0 (A:) automated matches {Desulfotalea psychrophila [TaxId: 84980]}
mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk

Timeline for d2uxra_:

• d2uxra_ first appeared in SCOPe 2.01
  
• d2uxra_ appears in SCOPe 2.07