Lineage for d2uwfa1 (2uwf A:11-360)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2439912Species Bacillus halodurans [TaxId:86665] [188453] (2 PDB entries)
  8. 2439913Domain d2uwfa1: 2uwf A:11-360 [168200]
    Other proteins in same PDB: d2uwfa2
    automated match to d1hiza_
    complexed with ca, cu

Details for d2uwfa1

PDB Entry: 2uwf (more details), 2.1 Å

PDB Description: crystal structure of family 10 xylanase from bacillus halodurans
PDB Compounds: (A:) alkaline active endoxylanase

SCOPe Domain Sequences for d2uwfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwfa1 c.1.8.3 (A:11-360) automated matches {Bacillus halodurans [TaxId: 86665]}
nqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpvslqpre
gewnwegadkivefarkhnmelrfhtlvwhsqvpewffidengnrmvdetdpekrkankq
lllermenhiktvverykddvtswdvvnevidddgglresewyqitgtdyikvafetark
yggeeaklyindyntevpskrddlynlvkdlleqgvpidgvghqshiqigwpsiedtras
fekftslgldnqvteldmslygwpptgaytsyddipeelfqaqadrydqlfelyeelsat
issvtfwgiadnhtwlddrareynngvgvdapfvfdhnyrvkpaywriid

SCOPe Domain Coordinates for d2uwfa1:

Click to download the PDB-style file with coordinates for d2uwfa1.
(The format of our PDB-style files is described here.)

Timeline for d2uwfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uwfa2