PDB entry 2uwf

View 2uwf on RCSB PDB site
Description: Crystal structure of family 10 xylanase from Bacillus halodurans
Class: hydrolase
Keywords: hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic, endoxylanase, bacillus halodurans, alkaline adaptation
Deposited on 2007-03-21, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline active endoxylanase
    Species: BACILLUS HALODURANS [TaxId:86665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q17TM8 (0-349)
      • conflict (0)
      • expression tag (350-355)
      • conflict (153)
    Domains in SCOPe 2.07: d2uwfa1, d2uwfa2
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2uwfA (A:)
nqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpvslqpre
gewnwegadkivefarkhnmelrfhtlvwhsqvpewffidengnrmvdetdpekrkankq
lllermenhiktvverykddvtswdvvnevidddgglresewyqitgtdyikvafetark
yggeeaklyindyntevpskrddlynlvkdlleqgvpidgvghqshiqigwpsiedtras
fekftslgldnqvteldmslygwpptgaytsyddipeelfqaqadrydqlfelyeelsat
issvtfwgiadnhtwlddrareynngvgvdapfvfdhnyrvkpaywriidhhhhhh