SCOPe 2.05: Domain d2uwab_: 2uwa B:

Lineage for d2uwab_ (2uwa B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Tropaeolum majus [TaxId:4020] [187334] (4 PDB entries)

8. Domain d2uwab_: 2uwa B: [168194]
   automated match to d1umza_
   complexed with gol

Details for d2uwab_

PDB Entry: 2uwa, 1.8 Å

PDB Description: crystal structure of the nasturtium seedling xyloglucanase isoform nxg1

PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d2uwab_:

Sequence; same for both SEQRES and ATOM records:

>d2uwab_ b.29.1.0 (B:) automated matches {Tropaeolum majus [TaxId: 4020]}
ayvqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinry
rsgyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfie
gsgdyniigremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrp
lwvygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygql
sqqqvaamewvqknymvynycddptrdhtltpec

Timeline for d2uwab_:

• d2uwab_ first appeared in SCOPe 2.01
  
• d2uwab_ appears in SCOPe 2.04
  
• d2uwab_ appears in SCOPe 2.06
  
• d2uwab_ appears in the current release, SCOPe 2.08