Lineage for d2uwab_ (2uwa B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781401Species Tropaeolum majus [TaxId:4020] [187334] (4 PDB entries)
  8. 2781403Domain d2uwab_: 2uwa B: [168194]
    automated match to d1umza_
    complexed with gol

Details for d2uwab_

PDB Entry: 2uwa (more details), 1.8 Å

PDB Description: crystal structure of the nasturtium seedling xyloglucanase isoform nxg1
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d2uwab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwab_ b.29.1.0 (B:) automated matches {Tropaeolum majus [TaxId: 4020]}
ayvqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinry
rsgyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfie
gsgdyniigremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrp
lwvygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygql
sqqqvaamewvqknymvynycddptrdhtltpec

SCOPe Domain Coordinates for d2uwab_:

Click to download the PDB-style file with coordinates for d2uwab_.
(The format of our PDB-style files is described here.)

Timeline for d2uwab_: