Lineage for d2rfgd_ (2rfg D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148735Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1148736Protein automated matches [190115] (32 species)
    not a true protein
  7. 1148812Species Hahella chejuensis [TaxId:158327] [188235] (1 PDB entry)
  8. 1148816Domain d2rfgd_: 2rfg D: [168084]
    automated match to d1dhpa_
    complexed with eoh, mg

Details for d2rfgd_

PDB Entry: 2rfg (more details), 1.5 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Hahella chejuensis at 1.5A resolution
PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2rfgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfgd_ c.1.10.0 (D:) automated matches {Hahella chejuensis [TaxId: 158327]}
mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyr

SCOPe Domain Coordinates for d2rfgd_:

Click to download the PDB-style file with coordinates for d2rfgd_.
(The format of our PDB-style files is described here.)

Timeline for d2rfgd_: