SCOPe 2.01: Domain d2rbfa_: 2rbf A:

Lineage for d2rbfa_ (2rbf A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
   in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker

6. Protein Bifunctional protein putA [158486] (1 species)

7. Species Escherichia coli [TaxId:562] [158487] (2 PDB entries)
   Uniprot P09546 3-45

8. Domain d2rbfa_: 2rbf A: [168044]
   automated match to d2ay0a1
   protein/DNA complex

Details for d2rbfa_

PDB Entry: 2rbf, 2.25 Å

PDB Description: structure of the ribbon-helix-helix domain of escherichia coli puta (puta52) complexed with operator dna (o2)

PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d2rbfa_:

Sequence; same for both SEQRES and ATOM records:

>d2rbfa_ a.43.1.11 (A:) Bifunctional protein putA {Escherichia coli [TaxId: 562]}
tttmgvklddatreriksaatridrtphwlikqaifsyleqlen

Timeline for d2rbfa_:

• d2rbfa_ is new in SCOPe 2.01-stable
  
• d2rbfa_ appears in SCOPe 2.02
  
• d2rbfa_ appears in the current release, SCOPe 2.08