![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins) in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker |
![]() | Protein Bifunctional protein putA [158486] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [158487] (2 PDB entries) Uniprot P09546 3-45 |
![]() | Domain d2rbfa_: 2rbf A: [168044] automated match to d2ay0a1 protein/DNA complex |
PDB Entry: 2rbf (more details), 2.25 Å
SCOPe Domain Sequences for d2rbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rbfa_ a.43.1.11 (A:) Bifunctional protein putA {Escherichia coli [TaxId: 562]} tttmgvklddatreriksaatridrtphwlikqaifsyleqlen
Timeline for d2rbfa_: