Lineage for d2rbfa_ (2rbf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712770Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
    in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker
  6. 2712771Protein Bifunctional protein putA [158486] (1 species)
  7. 2712772Species Escherichia coli [TaxId:562] [158487] (2 PDB entries)
    Uniprot P09546 3-45
  8. 2712779Domain d2rbfa_: 2rbf A: [168044]
    automated match to d2ay0a1
    protein/DNA complex

Details for d2rbfa_

PDB Entry: 2rbf (more details), 2.25 Å

PDB Description: structure of the ribbon-helix-helix domain of escherichia coli puta (puta52) complexed with operator dna (o2)
PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d2rbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbfa_ a.43.1.11 (A:) Bifunctional protein putA {Escherichia coli [TaxId: 562]}
tttmgvklddatreriksaatridrtphwlikqaifsyleqlen

SCOPe Domain Coordinates for d2rbfa_:

Click to download the PDB-style file with coordinates for d2rbfa_.
(The format of our PDB-style files is described here.)

Timeline for d2rbfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rbfb_