Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein ATP-dependent RNA helicase DDX25 [142310] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142311] (1 PDB entry) Uniprot Q9UHL0 307-474 |
Domain d2rb4b_: 2rb4 B: [168042] automated match to d2g2ja1 complexed with cl, so4, zn |
PDB Entry: 2rb4 (more details), 2.8 Å
SCOPe Domain Sequences for d2rb4b_:
Sequence, based on SEQRES records: (download)
>d2rb4b_ c.37.1.19 (B:) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]} ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvkqgeepdye tylhrigrtgrfgkkglafnmievdelpslmkiqdhfnssikqlnaedmd
>d2rb4b_ c.37.1.19 (B:) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]} ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvgeepdyety lhrigrtkglafnmievdelpslmkiqdhfnssikqlnaedmd
Timeline for d2rb4b_: