Lineage for d2ra4b_ (2ra4 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193305Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1193306Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1193307Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1193566Protein automated matches [190403] (2 species)
    not a true protein
  7. 1193567Species Human (Homo sapiens) [TaxId:9606] [187277] (9 PDB entries)
  8. 1193570Domain d2ra4b_: 2ra4 B: [168030]
    automated match to d1doma_
    complexed with so4, tfa

Details for d2ra4b_

PDB Entry: 2ra4 (more details), 1.7 Å

PDB Description: Crystal Structure of Human Monocyte Chemoattractant Protein 4 (MCP-4/CCL13)
PDB Compounds: (B:) Small-inducible cytokine A13

SCOPe Domain Sequences for d2ra4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ra4b_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dalnvpstccftfsskkislqrlksyvittsrcpqkavifrtklgkeicadpkekwvqny
mkhlg

SCOPe Domain Coordinates for d2ra4b_:

Click to download the PDB-style file with coordinates for d2ra4b_.
(The format of our PDB-style files is described here.)

Timeline for d2ra4b_: