| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
| Protein automated matches [190403] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries) |
| Domain d2ra4b_: 2ra4 B: [168030] automated match to d1doma_ complexed with so4, tfa |
PDB Entry: 2ra4 (more details), 1.7 Å
SCOPe Domain Sequences for d2ra4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ra4b_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dalnvpstccftfsskkislqrlksyvittsrcpqkavifrtklgkeicadpkekwvqny
mkhlg
Timeline for d2ra4b_: