Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins) |
Protein Ribonucleotide reductase R2 [47257] (9 species) |
Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries) |
Domain d2r2fa_: 2r2f A: [16802] |
PDB Entry: 2r2f (more details), 2.25 Å
SCOP Domain Sequences for d2r2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} srisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgl tlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaaya wseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntad lirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyae tgwvndvkaflcynankalmnlgyealfppemadvnpailaalspn
Timeline for d2r2fa_: