Lineage for d2r2fa_ (2r2f A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639250Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 639336Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries)
  8. 639339Domain d2r2fa_: 2r2f A: [16802]

Details for d2r2fa_

PDB Entry: 2r2f (more details), 2.25 Å

PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium (oxidized)
PDB Compounds: (A:) protein (ribonucleoside-diphosphate reductase small chain)

SCOP Domain Sequences for d2r2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 602]}
srisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgl
tlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaaya
wseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntad
lirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyae
tgwvndvkaflcynankalmnlgyealfppemadvnpailaalspn

SCOP Domain Coordinates for d2r2fa_:

Click to download the PDB-style file with coordinates for d2r2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2r2fa_: