![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (5 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins) |
![]() | Protein Ribonucleotide reductase R2 [47257] (8 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries) |
![]() | Domain d2r2fa_: 2r2f A: [16802] |
PDB Entry: 2r2f (more details), 2.25 Å
SCOP Domain Sequences for d2r2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 602]} srisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgl tlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaaya wseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntad lirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyae tgwvndvkaflcynankalmnlgyealfppemadvnpailaalspn
Timeline for d2r2fa_: