SCOPe 2.02: Domain d2r53a_: 2r53 A:

Lineage for d2r53a_ (2r53 A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein automated matches [190307] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187121] (3 PDB entries)

8. Domain d2r53a_: 2r53 A: [167989]
   automated match to d1m4ul_
   complexed with mpd

Details for d2r53a_

PDB Entry: 2r53, 2.1 Å

PDB Description: crystal structure analysis of bone morphogenetic protein-6 variant b2 (b2-bmp-6)

PDB Compounds: (A:) Bone morphogenetic protein 6

SCOPe Domain Sequences for d2r53a_:

Sequence; same for both SEQRES and ATOM records:

>d2r53a_ g.17.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krlkacrkhelyvsfqdlgwqdwiiapkgyaanycdgecsfplnahmnatnhaivqtlvh
lmnpeyvpkpccaptklnaisvlyfddnsnvilkkyrnmvvracgch

Timeline for d2r53a_:

• d2r53a_ first appeared in SCOPe 2.01
  
• d2r53a_ appears in SCOPe 2.03
  
• d2r53a_ appears in the current release, SCOPe 2.08