Lineage for d2r53a_ (2r53 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033789Protein automated matches [190307] (2 species)
    not a true protein
  7. 3033790Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries)
  8. 3033799Domain d2r53a_: 2r53 A: [167989]
    automated match to d1m4ul_
    complexed with mpd

Details for d2r53a_

PDB Entry: 2r53 (more details), 2.1 Å

PDB Description: crystal structure analysis of bone morphogenetic protein-6 variant b2 (b2-bmp-6)
PDB Compounds: (A:) Bone morphogenetic protein 6

SCOPe Domain Sequences for d2r53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r53a_ g.17.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krlkacrkhelyvsfqdlgwqdwiiapkgyaanycdgecsfplnahmnatnhaivqtlvh
lmnpeyvpkpccaptklnaisvlyfddnsnvilkkyrnmvvracgch

SCOPe Domain Coordinates for d2r53a_:

Click to download the PDB-style file with coordinates for d2r53a_.
(The format of our PDB-style files is described here.)

Timeline for d2r53a_: