SCOPe 2.02: Domain d2qxcd_: 2qxc D:

Lineage for d2qxcd_ (2qxc D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (22 PDB entries)

8. Domain d2qxcd_: 2qxc D: [167864]
   automated match to d1gzhc_
   complexed with zn; mutant

Details for d2qxcd_

PDB Entry: 2qxc, 1.85 Å

PDB Description: Human p53 Core Domain Mutant N239Y

PDB Compounds: (D:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2qxcd_:

Sequence; same for both SEQRES and ATOM records:

>d2qxcd_ b.2.5.2 (D:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

Timeline for d2qxcd_:

• d2qxcd_ first appeared in SCOPe 2.01
  
• d2qxcd_ does not appear in SCOPe 2.03