Lineage for d2qxbc_ (2qxb C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112950Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1112951Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1112952Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 1112953Species Human (Homo sapiens) [TaxId:9606] [49420] (22 PDB entries)
  8. 1112989Domain d2qxbc_: 2qxb C: [167859]
    automated match to d1gzha_
    complexed with zn; mutant

Details for d2qxbc_

PDB Entry: 2qxb (more details), 2.5 Å

PDB Description: Human p53 Core Domain Mutant N235K
PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2qxbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qxbc_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihykymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d2qxbc_:

Click to download the PDB-style file with coordinates for d2qxbc_.
(The format of our PDB-style files is described here.)

Timeline for d2qxbc_: