SCOPe 2.08: Domain d2qvbb_: 2qvb B:

Lineage for d2qvbb_ (2qvb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [188251] (3 PDB entries)

8. Domain d2qvbb_: 2qvb B: [167833]
   automated match to d1k5pa_
   complexed with cl, edo

Details for d2qvbb_

PDB Entry: 2qvb, 1.19 Å

PDB Description: crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis

PDB Compounds: (B:) Haloalkane dehalogenase 3

SCOPe Domain Sequences for d2qvbb_:

Sequence; same for both SEQRES and ATOM records:

>d2qvbb_ c.69.1.8 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
afgvepygqpkyleiagkrmayidegkgdaivfqhgnptssylwrnimphleglgrlvac
dligmgasdklspsgpdrysygeqrdflfalwdaldlgdhvvlvlhdwgsalgfdwanqh
rdrvqgiafmeaivtpmtwadwppavrgvfqgfrspqgepmalehnifvervlpgailrq
lsdeemnhyrrpfvnggedrrptlswprnlpidgepaevvalvneyrswleetdmpklfi
naepgaiitgrirdyvrswpnqteitvpgvhfvqedspeeigaaiaqfvrrlrsaag

Timeline for d2qvbb_:

• d2qvbb_ first appeared in SCOPe 2.01
  
• d2qvbb_ appears in SCOPe 2.07