Lineage for d1k5pa_ (1k5p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900280Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2900287Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)
  8. 2900292Domain d1k5pa_: 1k5p A: [90936]
    complexed with cl, mg

Details for d1k5pa_

PDB Entry: 1k5p (more details), 1.8 Å

PDB Description: Hydrolytic haloalkane dehalogenase LINB from sphingomonas paucimobilis UT26 at 1.8A resolution
PDB Compounds: (A:) 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase

SCOPe Domain Sequences for d1k5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5pa_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac
dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh
rervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrp
lseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfi
naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

SCOPe Domain Coordinates for d1k5pa_:

Click to download the PDB-style file with coordinates for d1k5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1k5pa_: