Lineage for d2qvba_ (2qvb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900319Protein automated matches [190880] (5 species)
    not a true protein
  7. 2900320Species Mycobacterium tuberculosis [TaxId:83332] [188251] (3 PDB entries)
  8. 2900322Domain d2qvba_: 2qvb A: [167832]
    automated match to d1k5pa_
    complexed with cl, edo

Details for d2qvba_

PDB Entry: 2qvb (more details), 1.19 Å

PDB Description: crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis
PDB Compounds: (A:) Haloalkane dehalogenase 3

SCOPe Domain Sequences for d2qvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qvba_ c.69.1.8 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
afgvepygqpkyleiagkrmayidegkgdaivfqhgnptssylwrnimphleglgrlvac
dligmgasdklspsgpdrysygeqrdflfalwdaldlgdhvvlvlhdwgsalgfdwanqh
rdrvqgiafmeaivtpmtwadwppavrgvfqgfrspqgepmalehnifvervlpgailrq
lsdeemnhyrrpfvnggedrrptlswprnlpidgepaevvalvneyrswleetdmpklfi
naepgaiitgrirdyvrswpnqteitvpgvhfvqedspeeigaaiaqfvrrlrsaag

SCOPe Domain Coordinates for d2qvba_:

Click to download the PDB-style file with coordinates for d2qvba_.
(The format of our PDB-style files is described here.)

Timeline for d2qvba_: