Lineage for d2quxe_ (2qux E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569071Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2569072Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2569073Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2569238Protein automated matches [190495] (3 species)
    not a true protein
  7. 2569253Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)
  8. 2569259Domain d2quxe_: 2qux E: [167821]
    Other proteins in same PDB: d2quxa2, d2quxg2, d2quxj2, d2quxk2
    automated match to d1dwna_
    protein/RNA complex; complexed with gol

Details for d2quxe_

PDB Entry: 2qux (more details), 2.44 Å

PDB Description: pp7 coat protein dimer in complex with rna hairpin
PDB Compounds: (E:) coat protein

SCOPe Domain Sequences for d2quxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quxe_ d.85.1.1 (E:) automated matches {Pseudomonas phage [TaxId: 12023]}
msktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkl
dqadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvpl
gr

SCOPe Domain Coordinates for d2quxe_:

Click to download the PDB-style file with coordinates for d2quxe_.
(The format of our PDB-style files is described here.)

Timeline for d2quxe_: