SCOPe 2.02: Domain d1fz5c_: 1fz5 C:

Lineage for d1fz5c_ (1fz5 C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)

8. Domain d1fz5c_: 1fz5 C: [16778]
   Other proteins in same PDB: d1fz5a_, d1fz5b_, d1fz5e_, d1fz5f_
   complexed with ca, fe2

Details for d1fz5c_

PDB Entry: 1fz5, 2.4 Å

PDB Description: methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme

PDB Compounds: (C:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz5c_:

Sequence; same for both SEQRES and ATOM records:

>d1fz5c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1fz5c_:

• d1fz5c_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz5c_ appears in SCOPe 2.01
  
• d1fz5c_ appears in SCOPe 2.03
  
• d1fz5c_ appears in the current release, SCOPe 2.08