Lineage for d1fz5c_ (1fz5 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265471Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1265556Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1265557Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1265602Domain d1fz5c_: 1fz5 C: [16778]
    Other proteins in same PDB: d1fz5a_, d1fz5b_, d1fz5e_, d1fz5f_
    complexed with ca, fe2

Details for d1fz5c_

PDB Entry: 1fz5 (more details), 2.4 Å

PDB Description: methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme
PDB Compounds: (C:) methane monooxygenase component a, beta chain

SCOPe Domain Sequences for d1fz5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz5c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1fz5c_:

Click to download the PDB-style file with coordinates for d1fz5c_.
(The format of our PDB-style files is described here.)

Timeline for d1fz5c_: