Lineage for d2qq4h_ (2qq4 H:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686645Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1686646Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1686700Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 1686701Protein automated matches [190942] (3 species)
    not a true protein
  7. 1686710Species Thermus thermophilus [TaxId:274] [188505] (1 PDB entry)
  8. 1686718Domain d2qq4h_: 2qq4 H: [167770]
    automated match to d1xjsa_
    complexed with zn

Details for d2qq4h_

PDB Entry: 2qq4 (more details), 1.85 Å

PDB Description: crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8
PDB Compounds: (H:) Iron-sulfur cluster biosynthesis protein IscU

SCOPe Domain Sequences for d2qq4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq4h_ d.224.1.0 (H:) automated matches {Thermus thermophilus [TaxId: 274]}
msvldelyreilldhyqsprnfgvlpqatkqaggmnpscgdqvevmvllegdtiadirfq
gqgcaistasaslmteavkgkkvaealelsrkfqamvvegappdptlgdllalqgvaklp
arvkcatlawhaleealr

SCOPe Domain Coordinates for d2qq4h_:

Click to download the PDB-style file with coordinates for d2qq4h_.
(The format of our PDB-style files is described here.)

Timeline for d2qq4h_: