| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
| Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
| Protein automated matches [190942] (3 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [188505] (1 PDB entry) |
| Domain d2qq4e_: 2qq4 E: [167767] automated match to d1xjsa_ complexed with zn |
PDB Entry: 2qq4 (more details), 1.85 Å
SCOPe Domain Sequences for d2qq4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qq4e_ d.224.1.0 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
svldelyreilldhyqsprnfgvlpqatkqaggmnpscgdqvevmvllegdtiadirfqg
qgcaistasaslmteavkgkkvaealelsrkfqamvvegappdptlgdllalqgvaklpa
rvkcatlawhaleealr
Timeline for d2qq4e_: