Lineage for d2qkqb_ (2qkq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001089Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2001134Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2001202Protein automated matches [190030] (1 species)
    not a true protein
  7. 2001203Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)
  8. 2001206Domain d2qkqb_: 2qkq B: [167700]
    automated match to d1b4fb_
    complexed with cl

Details for d2qkqb_

PDB Entry: 2qkq (more details), 2.1 Å

PDB Description: Structure of the SAM Domain of Human Ephrin Type-B Receptor 4
PDB Compounds: (B:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2qkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkqb_ a.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgsvgewlraikmgryeesfaaagfgsfelvsqisaedllrigvtlaghqkkilasvqh
m

SCOPe Domain Coordinates for d2qkqb_:

Click to download the PDB-style file with coordinates for d2qkqb_.
(The format of our PDB-style files is described here.)

Timeline for d2qkqb_: