| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein automated matches [190030] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187366] (1 PDB entry) |
| Domain d2qkqb_: 2qkq B: [167700] automated match to d1b4fb_ complexed with cl |
PDB Entry: 2qkq (more details), 2.1 Å
SCOPe Domain Sequences for d2qkqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkqb_ a.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgsvgewlraikmgryeesfaaagfgsfelvsqisaedllrigvtlaghqkkilasvqh
m
Timeline for d2qkqb_: