SCOPe 2.01: Domain d2qkqb_: 2qkq B:

Lineage for d2qkqb_ (2qkq B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein automated matches [190030] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187366] (1 PDB entry)

8. Domain d2qkqb_: 2qkq B: [167700]
   automated match to d1b4fb_
   complexed with cl

Details for d2qkqb_

PDB Entry: 2qkq, 2.1 Å

PDB Description: Structure of the SAM Domain of Human Ephrin Type-B Receptor 4

PDB Compounds: (B:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2qkqb_:

Sequence; same for both SEQRES and ATOM records:

>d2qkqb_ a.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgsvgewlraikmgryeesfaaagfgsfelvsqisaedllrigvtlaghqkkilasvqh
m

Timeline for d2qkqb_:

• d2qkqb_ is new in SCOPe 2.01-stable
  
• d2qkqb_ appears in SCOPe 2.02
  
• d2qkqb_ appears in the current release, SCOPe 2.08