Lineage for d2qcqa_ (2qcq A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638668Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2638669Protein automated matches [190506] (3 species)
    not a true protein
  7. 2638670Species Human (Homo sapiens) [TaxId:9606] [187459] (38 PDB entries)
  8. 2638687Domain d2qcqa_: 2qcq A: [167520]
    automated match to d1es7a_

Details for d2qcqa_

PDB Entry: 2qcq (more details), 2.21 Å

PDB Description: Crystal structure of Bone Morphogenetic Protein-3 (BMP-3)
PDB Compounds: (A:) Bone morphogenetic protein 3

SCOPe Domain Sequences for d2qcqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qcqa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eprncarrylkvdfadigwsewiispksfdayycsgacqfpmpkslkpsnhatiqsivra
vgvvpgipepccvpekmsslsilffdenknvvlkvypnmtvescacr

SCOPe Domain Coordinates for d2qcqa_:

Click to download the PDB-style file with coordinates for d2qcqa_.
(The format of our PDB-style files is described here.)

Timeline for d2qcqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qcqb_