SCOPe 2.07: Domain d2qcqb_: 2qcq B:

Lineage for d2qcqb_ (2qcq B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (38 PDB entries)

8. Domain d2qcqb_: 2qcq B: [167521]
   automated match to d1es7a_

Details for d2qcqb_

PDB Entry: 2qcq, 2.21 Å

PDB Description: Crystal structure of Bone Morphogenetic Protein-3 (BMP-3)

PDB Compounds: (B:) Bone morphogenetic protein 3

SCOPe Domain Sequences for d2qcqb_:

Sequence; same for both SEQRES and ATOM records:

>d2qcqb_ g.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieprncarrylkvdfadigwsewiispksfdayycsgacqfpmpkslkpsnhatiqsivr
avgvvpgipepccvpekmsslsilffdenknvvlkvypnmtvescacr

Timeline for d2qcqb_:

• d2qcqb_ first appeared in SCOPe 2.01
  
• d2qcqb_ appears in SCOPe 2.06
  
• d2qcqb_ appears in the current release, SCOPe 2.08