SCOPe 2.08: Domain d2q81c1: 2q81 C:2-114

Lineage for d2q81c1 (2q81 C:2-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d2q81c1: 2q81 C:2-114 [167468]
   Other proteins in same PDB: d2q81a2, d2q81b2, d2q81c2
   automated match to d1r28a_
   complexed with pg4

Details for d2q81c1

PDB Entry: 2q81, 2.1 Å

PDB Description: Crystal Structure of the Miz-1 BTB/POZ domain

PDB Compounds: (C:) Miz-1 protein

SCOPe Domain Sequences for d2q81c1:

Sequence; same for both SEQRES and ATOM records:

>d2q81c1 d.42.1.0 (C:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvvh
ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksl

Timeline for d2q81c1:

• d2q81c1 first appeared in SCOPe 2.01, called d2q81c_
  
• d2q81c1 appears in SCOPe 2.07