SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2q81d_ (2q81 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169177Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2169178Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2169402Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2169403Protein automated matches [190710] (3 species)
    not a true protein
  7. 2169404Species Human (Homo sapiens) [TaxId:9606] [187857] (36 PDB entries)
  8. 2169420Domain d2q81d_: 2q81 D: [167469]
    Other proteins in same PDB: d2q81a2, d2q81b2, d2q81c2
    automated match to d1r28a_
    complexed with pg4

Details for d2q81d_

PDB Entry: 2q81 (more details), 2.1 Å

PDB Description: Crystal Structure of the Miz-1 BTB/POZ domain
PDB Compounds: (D:) Miz-1 protein

SCOPe Domain Sequences for d2q81d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q81d_ d.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvvh
ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksla

SCOPe Domain Coordinates for d2q81d_:

Click to download the PDB-style file with coordinates for d2q81d_.
(The format of our PDB-style files is described here.)

Timeline for d2q81d_: