Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins) contains all-alpha subdomain inserted after the first strand |
Protein Uncharacterized protein BH0493 [159395] (1 species) |
Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries) Uniprot Q9KFI6 1-423 |
Domain d2q08d_: 2q08 D: [167374] automated match to d2pnka1 complexed with zn |
PDB Entry: 2q08 (more details), 2 Å
SCOPe Domain Sequences for d2q08d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q08d_ c.1.9.8 (D:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvg
Timeline for d2q08d_: