Lineage for d2q08e_ (2q08 E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084686Family c.1.9.8: Uronate isomerase-like [75082] (2 protein domains)
    contains all-alpha subdomain inserted after the first strand
  6. 2084687Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 2084688Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 2084720Domain d2q08e_: 2q08 E: [167375]
    automated match to d2pnka1
    complexed with zn

Details for d2q08e_

PDB Entry: 2q08 (more details), 2 Å

PDB Description: Crystal structure of the protein BH0493 from Bacillus halodurans C-125 complexed with ZN
PDB Compounds: (E:) BH0493 protein

SCOPe Domain Sequences for d2q08e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q08e_ c.1.9.8 (E:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvg

SCOPe Domain Coordinates for d2q08e_:

Click to download the PDB-style file with coordinates for d2q08e_.
(The format of our PDB-style files is described here.)

Timeline for d2q08e_: