Lineage for d2pwmb_ (2pwm B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091822Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1091823Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 1091824Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1091863Protein HIV-1 capsid protein [47945] (1 species)
  7. 1091864Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (19 PDB entries)
  8. 1091888Domain d2pwmb_: 2pwm B: [167303]
    automated match to d1afva_
    complexed with cl

Details for d2pwmb_

PDB Entry: 2pwm (more details), 1.9 Å

PDB Description: crystal structure of hiv-1 ca146 a92e real cell
PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2pwmb_:

Sequence, based on SEQRES records: (download)

>d2pwmb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Sequence, based on observed residues (ATOM records): (download)

>d2pwmb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge
iykrwiilglnkivrmy

SCOPe Domain Coordinates for d2pwmb_:

Click to download the PDB-style file with coordinates for d2pwmb_.
(The format of our PDB-style files is described here.)

Timeline for d2pwmb_: